PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK02302.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 284aa    MW: 31070.7 Da    PI: 9.2643
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK02302.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.3e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +W+++E++++v+av+++G + Wk+I + +g ++t+ q++s+ qk+
        PK02302.1  67 RESWSEQEHQKFVEAVQLFGRD-WKKIEAFVG-TKTAVQIRSHAQKH 111
                      789*****************77.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.35E-1561114IPR009057Homeodomain-like
PROSITE profilePS5129420.50262116IPR017930Myb domain
TIGRFAMsTIGR015571.1E-1665114IPR006447Myb domain, plants
SMARTSM007172.2E-1366114IPR001005SANT/Myb domain
PfamPF002496.7E-1567111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-1067116IPR009057Homeodomain-like
CDDcd001671.01E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MVSPNRNPAQ GFSYPHSSNM HNDLPGINSM QPPENTIPSP TANVNTTSFE VPPTKKIRKP  60
YTITKSRESW SEQEHQKFVE AVQLFGRDWK KIEAFVGTKT AVQIRSHAQK HFEKVLKSGI  120
KERVPPPRPK KKATHPYPHK SPTDAPNVAQ FNGATNVTQS TGASYFTHAN GFPIVTYMTG  180
SPTVAHFTGA PTFTNDNGDP AMSHFDWTPA VTHVAGSPNV THDTGPFHYS AALYEPAFCS  240
PHSSSAVVNP INGASSPPWR SSSAPPVILP QLETDVEWLS IPEL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010092585.11e-59Transcription factor ASG4
TrEMBLW9RDD51e-59W9RDD5_9R
STRINGPOPTR_0014s08520.13e-52(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29563372
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01520.18e-42MYB_related family protein